|

Author: Farida Najafguliyeva

License: Pexels License

Resolution: 1567x2351

AI Image tools

More AI tools by promeai.pro

Source: pexels.com

red petalsfallen petalsdried petalsoiranchristmas ribbondried flower
a close up of a basket on a christmas tree, a digital rendering, pexels, baroque, wide ribbons, crimson themed, mix, opening shot

a close up of a basket on a christmas tree, a digital rendering, pexels, baroque, wide ribbons, crimson themed, mix, opening shot

Author: Farida Najafguliyeva

License: Pexels License

Resolution: 1567x2351

AI Image tools

More AI tools by promeai.pro

Source: pexels.com

More similar content

a close up of a basket on a christmas tree, a digital rendering, pexels, baroque, wide ribbons, crimson themed, mix, opening shotCopyright free image Generator >
red petalsfallen petalsdried petalsoiranchristmas ribbondried flowerabstract flowerschristmas gold and red decochristmas backgroundchristmas motif
some christmas decorations are lined up on the tableCopyright free image Generator >
christmas garlandchristmas gold and red decogarlandsthai garlandchristmas gold foilgold foil christmaschristmas wreathgarland of lightsglass decorationsgolden wreath
a woman holding a bouquet of red and white roses, an album cover, inspired by Elsa Bleda, trending on unsplash, 4 k photo autochrome, a high angle shot, ribbon, flirtingCopyright free image Generator >
vintage flowersretro flowersartificial flowerspaper flower backgroundcut flowersflower arrangement lyingpaper flowersvintage backgroundpaper rosesartificial flower
a black and silver mask on a red and gold backgroundCopyright free image Generator >
venetian maskmasqueradering with ornamentla calavera catrinagarlandsmasqueradingday of the dead framehalloween backgroundfloral ornamentdiadem spider
red and silver decorations are featured on the tableCopyright free image Generator >
christmas balls backgroundchristmas motifglass decorationsglass ornamentchristmas backgroundred snowflaketannenbaumkerschbaumchristmas wallpaperchristmas decoration
an array of decorations sits on top of a decorated christmas treeCopyright free image Generator >
christmas motifchristmas backgroundmultiple exposurechristmas flowerdefocusfractal environmentchristmas balls backgroundmultispectralred treechristmas garland
a person doing some kind of lace work on a dressCopyright free image Generator >
dulhanindian brideshaadibharathanatyamwedding detailssabyasachinihangwedding photographydiabladadead bride
a close up of a plate of food on a table, a detailed painting, inspired by Shōzō Shimamoto, reddit, process art, made of liquid purple metal, 144x144 canvas, dynamic closeup, detail textureCopyright free image Generator >
paithani silkkimono fabricraw silktextilebrakhagetextilesfabric textureembroideriesshiboridamask paper
a red and gold christmas decoration with lightsCopyright free image Generator >
christmas gold and red decochristmas flowergolden wreathgold leavesgold foil christmaschristmas gold foilchristmas garlandflower christmasglitter leavesgolden flowers
christmas tree with gold and silver decorationsCopyright free image Generator >
gold leavesgold leafgolden rainfish goldgold fishgold spangleblack-red goldpailletteschristmas gold and red decoforest floor
a bunch of brightly colored paper flowers sitting in front of each otherCopyright free image Generator >
colorful glassglass decorationschristmas balls backgroundcolored lightsabstract multicolorglass ornamentkaleidoscapegarland of lightsluminous garlandabstract flowers
a close up of a person lighting a candle, hurufiyya, red and gold sumptuous garb, hindu, led, vibrant settingCopyright free image Generator >
diwali backgroundtealightpadmavathidiwali wallpaperred lanterndeepawalidiwali bannerdiwaliglitterslacquer
a close up of a person lighting a candle, hindu ornaments, orange lights, flatlay, red and goldCopyright free image Generator >
diwali backgrounddiwali festivalhindu ritualssangeethdeepavaliashtavinayakpadmavathiofferingpujaskrishnas
a close up of a fire with the flame on topCopyright free image Generator >
fire danceembersfire dancerfire backgrounddancing flamesyagyafiredancerabstract smokefire makingflame spirit
someone is holding an item made up of glassCopyright free image Generator >
bokeh lightsbackground bokehbokeh effectsequinneddefocusbokeh heartsglitteringbokehsparklessparkle
the camera lens is reflected on a person's faceCopyright free image Generator >
bokehbokeh lightsbackground bokehdefocuscrystal ball-photographybokeh effectlensballlensbabybokeh heartsphotorefractive
a christmas tree with ornaments all over itCopyright free image Generator >
christmas motifchristmas balls backgroundornamentschristmas framechristmas backgroundchristmas starschristmas starchristmas ribbonchristmas wallpaperframe ornaments
a couple of women standing next to each other, a portrait, inspired by Konstantin Somov, unsplash, rococo, red hat, mirrored, portrait of billie eilish, high angle closeup portraitCopyright free image Generator >
dried rosepaper flowersdead bridepaper rosered carnationfabric flowersfabric rosespaper rosescrumpledhemorrhage
a close up of a bunch of ornaments on a string, a digital rendering, unsplash, baroque, detailed red lighting, shot on sony a 7 iii, pink and gold, shot with premium dslr cameraCopyright free image Generator >
bokeh heartsbackground bokehbokeh effectbokeh lightsornamentbaubleschristmas balls backgroundchristmas ball ornamentornamentschristmas ornaments
three different pillows and one with fringes on topCopyright free image Generator >
odalisquegartercrinolinesvenetian maskpaithani silkbedspreadrope detailwoman on bedpallucushion

Immerse is a multi-modality reverse image search engine based on proprietary technology with intellectual property rights. Trained on large-scale high quality visio-linguistic datasets, the underlying artificial intelligence model is capable of generating highly accurate search results by semantically understanding the query and target information across image and text modalities.

As an image reverse search engine, professionals such as marketing operators, magazine editors, advertising designers, and e-commerce shop owners can obtain high-quality, royalty-free materials through Immerse.It also facilitates businesses in image asset management in terms of image indexing and precise image search engine deployment in order to boost user engagement and conversion.

© 2018-2024 immerse.zone